PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G002900.2
Common NamePHAVU_005G002900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family FAR1
Protein Properties Length: 243aa    MW: 27993.6 Da    PI: 6.4255
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G002900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR187.42.1e-2778166290
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         fY+eYA++vGF +r+ + ++s+r+g+i  r++ C+keg+  + + k ++ r++ra+tr gCka++++k ek+gkw++tk++++HnH+l+
  Phvul.005G002900.2  78 FYDEYARRVGFVMRVMSCRRSERDGRILARRLGCNKEGYCVSIRGKFSSVRKPRASTREGCKAMIHIKYEKSGKWVITKFVKDHNHPLV 166
                         9**************************************999999989***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.0E-2578166IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MESQLVDRND AMEVSGDVDL STYEVQVEQE TYKVDPNEGC RVLESSSGGE LGICDDDHAI  60
QEPYEGLEFE SEDAAKIFYD EYARRVGFVM RVMSCRRSER DGRILARRLG CNKEGYCVSI  120
RGKFSSVRKP RASTREGCKA MIHIKYEKSG KWVITKFVKD HNHPLVVSPR EARQTMDEKD  180
KKIQELTAEL RHKKRLCATY QEQLTSFMKV VEEHNEKLST KIHHVVNNLK EFESIDELLH  240
QT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007148636.10.0hypothetical protein PHAVU_005G002900g
RefseqXP_007148637.10.0hypothetical protein PHAVU_005G002900g
RefseqXP_007148638.10.0hypothetical protein PHAVU_005G002900g
TrEMBLV7BRL20.0V7BRL2_PHAVU; Uncharacterized protein
STRINGGLYMA06G48170.31e-167(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.11e-106FAR1 family protein